DPYSL3 monoclonal antibody (M01), clone 1B8

• Catalog Number: orb2293496
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant DPYSL3.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1B8
• Tested applications: ELISA, IHC-P, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: DPYSL3 (NP_001378, 457 a.a. ~ 555 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: GNLHVTQGAGRFIPCSPFSDYVYKRIKARRKMADLHAVPRGMYDGPVFDLTTTPKGGTPAGSARGSPTRPNPPVRNLHQSGFSLSGTQVDEGVRSASKR
• NCBI: NP_001378
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged DPYSL3 is 0.3 ng/ml as a capture antibody.

DPYSL3 monoclonal antibody (M01), clone 1B8 Western Blot analysis of DPYSL3 expression in Jurkat.

Immunoperoxidase of monoclonal antibody to DPYSL3 on formalin-fixed paraffin-embedded human ovary. [antibody concentration 3 ug/ml]

Western Blot detection against Immunogen (36.63 KDa).