DPH1 monoclonal antibody (M02), clone 2C5

• Catalog Number: orb2293514
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant DPH1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2C5
• Tested applications: ELISA, IF, WB
• Reactivity: Human
• Isotype: IgG2b Kappa
• Immunogen: DPH1 (NP_001374, 216 a.a. ~ 324 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: ILGCTSPRLSKEVEAVVYLGDGRFHLESVMIANPNVPAYRYDPYSKVLSREHYDHQRMQAARQEAIATARSAKSWGLILGTLGRQGSPKILEHLESRLRALGLSFVRLL
• NCBI: NP_001374
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

DPH1 monoclonal antibody (M02), clone 2C5 Western Blot analysis of DPH1 expression in HeLa.

Immunofluorescence of monoclonal antibody to DPH1 on HeLa cell. [antibody concentration 10 ug/ml]