DPF2 monoclonal antibody (M01), clone 2F6

• Catalog Number: orb2292269
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant DPF2.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2F6
• Tested applications: ELISA, IF, IHC-P, WB
• Reactivity: Human
• Isotype: IgG2a kappa
• Immunogen: DPF2 (AAH14889, 56 a.a. ~ 155 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: WMEKRHRGPGLASGQLYSYPARRWRKKRRAHPPEDPRLSFPSIKPDTDQTLKKEGLISQDGSSLEALLRTDPLEKRGAPDPRVDDDSLGEFPVTNSRARK
• NCBI: AAH14889
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

DPF2 monoclonal antibody (M01), clone 2F6 Western Blot analysis of DPF2 expression in LNCaP.

Immunofluorescence of monoclonal antibody to DPF2 on HeLa cell. [antibody concentration 10 ug/ml]

Immunoperoxidase of monoclonal antibody to DPF2 on formalin-fixed paraffin-embedded human ovary, clear cell carcinoma. [antibody concentration 6 ug/ml]

Western Blot analysis of DPF2 expression in transfected 293T cell line by DPF2 monoclonal antibody (M01), clone 2F6. Lane 1: DPF2 transfected lysate (44 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.63 KDa).