You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2292269 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant DPF2. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 2F6 |
Tested applications | ELISA, IF, IHC-P, WB |
Reactivity | Human |
Isotype | IgG2a kappa |
Immunogen | DPF2 (AAH14889, 56 a.a. ~ 155 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | WMEKRHRGPGLASGQLYSYPARRWRKKRRAHPPEDPRLSFPSIKPDTDQTLKKEGLISQDGSSLEALLRTDPLEKRGAPDPRVDDDSLGEFPVTNSRARK |
NCBI | AAH14889 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
DPF2 monoclonal antibody (M01), clone 2F6 Western Blot analysis of DPF2 expression in LNCaP.
Immunofluorescence of monoclonal antibody to DPF2 on HeLa cell. [antibody concentration 10 ug/ml]
Immunoperoxidase of monoclonal antibody to DPF2 on formalin-fixed paraffin-embedded human ovary, clear cell carcinoma. [antibody concentration 6 ug/ml]
Western Blot analysis of DPF2 expression in transfected 293T cell line by DPF2 monoclonal antibody (M01), clone 2F6. Lane 1: DPF2 transfected lysate (44 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (36.63 KDa).