DOT1L monoclonal antibody (M01), clone 6A6

• Catalog Number: orb2290747
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant DOT1L.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 6A6
• Tested applications: ELISA, IF, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: DOT1L (NP_115871, 3 a.a. ~ 108 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: EKLELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVLIDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSTGLLR
• NCBI: NP_115871
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged DOT1L is approximately 0.03 ng/ml as a capture antibody.

DOT1L monoclonal antibody (M01), clone 6A6. Western Blot analysis of DOT1L expression in LNCaP.

Immunofluorescence of monoclonal antibody to DOT1L on HeLa cell. [antibody concentration 10 ug/ml]

Western Blot detection against Immunogen (37.4 KDa).