Doppel/PRND Antibody

• Catalog Number: orb443212
• Category: Antibodies
• Description: Doppel/PRND Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence of human Doppel (ATQAANQGEFQKPDNKLHQQVLWRLVQELCSLKH).
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 23 kDa
• UniProt ID: Q9UKY0
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Prion-like protein doppel; PrPLP; Prion protein 2;
• Note: For research use only
• Application notes: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

WB analysis of Doppel using anti-Doppel antibody.Lane 1:human SHG-44 Cell;2:rat testis tissue;3:rat kidney tissue;4:mouse testis tissue;5:mouse kidney tissue;6:mouse brain tissue.

IHC analysis of Doppel using anti-Doppel antibody.Doppel was detected in paraffin-embedded section of mouse testis tissue.

IHC analysis of Doppel using anti-Doppel antibody.Doppel was detected in paraffin-embedded section of human testis tissue.