You have no items in your shopping cart.
Cart summary
DOG1 Protein, S. cerevisiae, Recombinant (His)
Catalog Number: orb1976492
| Catalog Number | orb1976492 |
|---|---|
| Category | Proteins |
| Description | Active on 2-DOG-6P, also very active on fructose-1P. DOG1 Protein, S. cerevisiae, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 29.1 kDa and the accession number is P38774. |
| Tag | N-6xHis |
| Purity | 98.00% |
| MW | 29.1 kDa (predicted) |
| UniProt ID | P38774 |
| Protein Sequence | MAEFSADLCLFDLDGTIVSTTVAAEKAWTKLCYEYGVDPSELFKHSHGARTQEVLRRFFPKLDDTDNKGVLALEKDIAHSYLDTVSLIPGAENLLLSLDVDTETQKKLPERKWAIVTSGSPYLAFSWFETILKNVGKPKVFITGFDVKNGKPDPEGYSRARDLLRQDLQLTGKQDLKYVVFEDAPVGIKAGKAMGAITVGITSSYDKSVLFDAGADYVVCDLTQVSVVKNNENGIVIQVNNPLTRA |
| Expression System | P. pastoris (Yeast) |
| Biological Origin | Saccharomyces cerevisiae |
| Biological Activity | Active on 2-DOG-6P, also very active on fructose-1P. DOG1 Protein, S. cerevisiae, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 29.1 kDa and the accession number is P38774. |
| Expression Region | 1-246 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
