DNA Polymerase iota/POLI Antibody

• Catalog Number: orb413052
• Category: Antibodies
• Description: DNA Polymerase iota/POLI Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence of human DNA Polymerase iota (DIDPQVFYELPEAVQKELLAEWKRAGSDFHIGHK).
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 83 kDa
• UniProt ID: Q9UNA4
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: DNA polymerase iota; Eta2; RAD30 homolog B; POLI;
• Note: For research use only
• Application notes: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

WB analysis using anti-DNA Polymerase iota antibody.Lane 1:rat testis tissue;2:rat testis tissue;3:rat kidney tissue;4:rat stomach tissue;5:mouse testis tissue;6:mouse testis tissue;7:mouse kidney tissue;8:mouse stomach tissue.

WB analysis of DNA Polymerase iota using anti-DNA Polymerase iota antibody.Lane 1:human HeLa cell;2:human placenta tissue;3:human A549 cell;4:human SK-OV-3 cell.