You have no items in your shopping cart.
Cart summary
Item 1 of 5
Item 1 of 5
DLX4 monoclonal antibody (M01), clone 1F11
Catalog Number: orb2293571
| Catalog Number | orb2293571 |
|---|---|
| Category | Antibodies |
| Description | Mouse monoclonal antibody raised against a partial recombinant DLX4. |
| Species/Host | Mouse |
| Clonality | Monoclonal |
| Clone Number | 1F11 |
| Tested applications | ELISA, IP, WB |
| Reactivity | Human |
| Isotype | IgG2a Kappa |
| Immunogen | DLX4 (AAH16145, 1 a.a. ~ 98 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Conjugation | Unconjugated |
| Protein Sequence | MTSLPCPLPGRDASKAVFPDLAPVPSVAAAYPLGLSPTTAASPNLSYSRPYGHLLSYPYTEPANPGDSYLSCQQPAALSQPLCGPAEHPQELEADSEK |
| NCBI | AAH16145 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | In 1x PBS, pH 7.4 |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
Western Blot detection against Immunogen (36.52 KDa).
Detection limit for recombinant GST tagged DLX4 is approximately 0.03 ng/ml as a capture antibody.
Immunoprecipitation of DLX4 transfected lysate using anti-DLX4 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with DLX4 MaxPab rabbit polyclonal antibody.
Western Blot analysis of DLX4 expression in transfected 293T cell line by DLX4 monoclonal antibody (M01), clone 1F11. Lane 1: DLX4 transfected lysate (26 KDa). Lane 2: Non-transfected lysate.
Western blot analysis of DLX4 over-expressed 293 cell line, cotransfected with DLX4 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with DLX4 monoclonal antibody (M01), clone 1F11 (Cat # orb2293571). GAPDH (36.1 kDa) used as specificity and loading control.
