DLX4 MaxPab rabbit polyclonal antibody (D01)

• Catalog Number: orb2293573
• Category: Antibodies
• Description: Rabbit polyclonal antibody raised against a full-length human DLX4 protein.
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IP, WB
• Reactivity: Human
• Immunogen: DLX4 (NP_612138.1, 1 a.a. ~ 240 a.a) full-length human protein.
• Conjugation: Unconjugated
• Protein Sequence: MTSLPCPLPGRDASKAVFPDLAPVPSVAAAYPLGLSPTTAASPNLSYSRPYGHLLSYPYTEPANPGDSYLSCQQPAALSQPLCGPAEHPQELEADSEKPRLSPEPSERRPQAPAKKLRKPRTIYSSLQLQHLNQRFQHTQYLALPERAQLAAQLGLTQTQVKIWFQNKRSKYKKLLKQNSGGQEGDFPGRTFSVSPCSPPLPSLWDLPKAGTLPTSGYGNSFGAWYQHHSSDVLASPQMM
• NCBI: NP_612138.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: No additive
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunoprecipitation of DLX4 transfected lysate using anti-DLX4 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with DLX4 MaxPab mouse polyclonal antibody (B01) (orb2293574).

Western Blot analysis of DLX4 expression in transfected 293T cell line by DLX4 MaxPab polyclonal antibody. Lane 1: DLX4 transfected lysate (26.30 KDa). Lane 2: Non-transfected lysate.