You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2293599 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody raised against a full-length human DLST protein. |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IF, WB |
Reactivity | Human |
Immunogen | DLST (NP_001924.2, 1 a.a. ~ 453 a.a) full-length human protein. |
Conjugation | Unconjugated |
Protein Sequence | MLSRSRCVSRAFSRSLSAFQKGNCPLGRRSLPGVSLCQGPGYPNSRKVVINNSVFSVRFFRTTAVCKDDLVTVKTPAFAESVTEGDVRWEKAVGDTVAEDEVVCEIETDKTSVQVPSPANGVIEALLVPDGGKVEGGTPLFTLRKTGAAPAKAKPAEAPAAAAPKAEPTAAAVPPPAAPIPTQMPPVPSPSQPPSGKPVSAVKPTVAPPLAEPGAGKGLRSEHREKMNRMRQRIAQRLKEAQNTCAMLTTFNEIDMSNIQEMRARHKEAFLKKHNLKLGFMSAFVKASAFALQEQPVVNAVIDDTTKEVVYRDYIDISVAVATPRGLVVPVIRNVEAMNFADIERTITELGEKARKNELAIEDMDGGTFTISNGGVFGSLFGTPIINPPQSAILGMHGIFDRPVAIGGKVEVRPMMYVALTYDHRLIDGREAVTFLRKIKAAVEDPRVLLLDL |
NCBI | NP_001924.2 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
DLST MaxPab rabbit polyclonal antibody. Western Blot analysis of DLST expression in HepG2.
DLST MaxPab rabbit polyclonal antibody. Western Blot analysis of DLST expression in human kidney.
Immunofluorescence of purified MaxPab antibody to DLST on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot analysis of DLST expression in transfected 293T cell line by DLST MaxPab polyclonal antibody. Lane 1: DLST transfected lysate (48.80 KDa). Lane 2: Non-transfected lysate.