DLST purified MaxPab mouse polyclonal antibody (B01P)

• Catalog Number: orb2293601
• Category: Antibodies
• Description: Mouse polyclonal antibody raised against a full-length human DLST protein.
• Species/Host: Mouse
• Clonality: Polyclonal
• Tested applications: IF, WB
• Reactivity: Human
• Immunogen: DLST (NP_001924.2, 1 a.a. ~ 453 a.a) full-length human protein.
• Conjugation: Unconjugated
• Protein Sequence: MLSRSRCVSRAFSRSLSAFQKGNCPLGRRSLPGVSLCQGPGYPNSRKVVINNSVFSVRFFRTTAVCKDDLVTVKTPAFAESVTEGDVRWEKAVGDTVAEDEVVCEIETDKTSVQVPSPANGVIEALLVPDGGKVEGGTPLFTLRKTGAAPAKAKPAEAPAAAAPKAEPTAAAVPPPAAPIPTQMPPVPSPSQPPSGKPVSAVKPTVAPPLAEPGAGKGLRSEHREKMNRMRQRIAQRLKEAQNTCAMLTTFNEIDMSNIQEMRARHKEAFLKKHNLKLGFMSAFVKASAFALQEQPVVNAVIDDTTKEVVYRDYIDISVAVATPRGLVVPVIRNVEAMNFADIERTITELGEKARKNELAIEDMDGGTFTISNGGVFGSLFGTPIINPPQSAILGMHGIFDRPVAIGGKVEVRPMMYVALTYDHRLIDGREAVTFLRKIKAAVEDPRVLLLDL
• NCBI: NP_001924.2
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

DLST MaxPab polyclonal antibody. Western Blot analysis of DLST expression in HepG2.

DLST MaxPab polyclonal antibody. Western Blot analysis of DLST expression in human liver.

Immunofluorescence of purified MaxPab antibody to DLST on HeLa cell. [antibody concentration 10 ug/ml]

Western Blot analysis of DLST expression in transfected 293T cell line by DLST MaxPab polyclonal antibody. Lane 1: DLST transfected lysate (49.83 KDa). Lane 2: Non-transfected lysate.