You have no items in your shopping cart.
Cart summary
DLST antibody
Catalog Number: orb591959
| Catalog Number | orb591959 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to DLST |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | WB |
| Predicted Reactivity | Mouse |
| Reactivity | Mouse |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse DLST |
| Concentration | 0.5 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 49 kDa |
| Target | DLST |
| UniProt ID | Q9D2G2 |
| Protein Sequence | Synthetic peptide located within the following region: SSKPVSAIKPTAAPPLAEAGAAKGLRSEHREKMNRMRQRIAQRLKEAQNT |
| NCBI | NP_084501.1 |
| Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Alternative names | DLTS, 1600017E01Rik, 4632413C10Rik, 4930529O08Rik Read more... |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
- Item 1 of 7
- Item 1 of 5
DLST antibody [orb539205]
IF, IHC, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μl - Item 1 of 4
- Item 1 of 4
- Item 1 of 4
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars