DLG3 monoclonal antibody (M03), clone 2B6

• Catalog Number: orb2293606
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant DLG3.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2B6
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: DLG3 (NP_066943, 281 a.a. ~ 380 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: VNNTNLQDVRHEEAVASLKNTSDMVYLKVAKPGSLHLNDMYAPPDYASTFTALADNHISHNSSLGYLGAVESKVSYPAPPQVPPTRYSPIPRHMLAEEDF
• NCBI: NP_066943
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western Blot analysis of DLG3 expression in transfected 293T cell line by DLG3 monoclonal antibody (M03), clone 2B6. Lane 1: DLG3 transfected lysate (90.3 KDa). Lane 2: Non-transfected lysate.

Western blot analysis of DLG3 over-expressed 293 cell line, cotransfected with DLG3 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with DLG3 monoclonal antibody (M03), clone 2B6 (Cat # orb2293606). GAPDH (36.1 kDa) used as specificity and loading control.

Western Blot detection against Immunogen (36.74 KDa).