You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb614111 |
---|---|
Category | Antibodies |
Description | DHX15/prp43 Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | FC, ICC, IF, IHC, WB |
Reactivity | Human, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence of human DHX15/prp43 (DIKPEWLVKIAPQYYDMSNFPQCEAKRQLDRIIAKLQSKEYSQY). |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Dilution range | Western blot, 0.25-0.5μg/ml, Human, Mouse, Rat Immunohistochemistry (Paraffin-embedded Section), 2-5μg/ml, Human Immunocytochemistry/Immunofluorescence, 5μg/ml, Human Flow Cytometry(Fixed), 1-3μg/1x106 cells, Human |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 91 kDa |
UniProt ID | O43143 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Pre-mRNA-splicing factor ATP-dependent RNA helicas Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
WB analysis using anti-DHX15/prp43 antibody.Lane 1:HeLa cell, Lane 2:293T cell, Lane 3:RT4 cell.
IF analysis of DHX15/prp43 using anti-DHX15/prp43 antibody.
Flow Cytometry analysis of Ana-1 cells using anti-DHX15 antibody(Blue line).Isotype control antibody (Green line) was rabbit IgG.Unlabelled sample (Red line) was also used as a control.
Flow Cytometry analysis of A431 cells using anti-DHX15 antibody(Blue line).Isotype control antibody (Green line) was rabbit IgG.Unlabelled sample (Red line) was also used as a control.
IHC analysis of DHX15 using anti-DHX15 antibody.
IHC analysis of DHX15 using anti-DHX15 antibody.
IHC analysis of DHX15 using anti-DHX15 antibody.
IHC analysis of DHX15 using anti-DHX15 antibody.
IHC analysis of DHX15 using anti-DHX15 antibody.
IHC analysis of DHX15 using anti-DHX15 antibody.
IHC analysis of DHX15 using anti-DHX15 antibody.
Filter by Rating