DHX15/prp43 Antibody

• Catalog Number: orb614111
• Category: Antibodies
• Description: DHX15/prp43 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: FC, ICC, IF, IHC, WB
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence of human DHX15/prp43 (DIKPEWLVKIAPQYYDMSNFPQCEAKRQLDRIIAKLQSKEYSQY).
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.25-0.5μg/ml, Human, Mouse, Rat Immunohistochemistry (Paraffin-embedded Section), 2-5μg/ml, Human Immunocytochemistry/Immunofluorescence, 5μg/ml, Human Flow Cytometry(Fixed), 1-3μg/1x106 cells, Human
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 91 kDa
• UniProt ID: O43143
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Pre-mRNA-splicing factor ATP-dependent RNA helicas
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

WB analysis using anti-DHX15/prp43 antibody.Lane 1:HeLa cell, Lane 2:293T cell, Lane 3:RT4 cell.

IF analysis of DHX15/prp43 using anti-DHX15/prp43 antibody.

Flow Cytometry analysis of Ana-1 cells using anti-DHX15 antibody(Blue line).Isotype control antibody (Green line) was rabbit IgG.Unlabelled sample (Red line) was also used as a control.

Flow Cytometry analysis of A431 cells using anti-DHX15 antibody(Blue line).Isotype control antibody (Green line) was rabbit IgG.Unlabelled sample (Red line) was also used as a control.

IHC analysis of DHX15 using anti-DHX15 antibody.

IHC analysis of DHX15 using anti-DHX15 antibody.

IHC analysis of DHX15 using anti-DHX15 antibody.

IHC analysis of DHX15 using anti-DHX15 antibody.

IHC analysis of DHX15 using anti-DHX15 antibody.

IHC analysis of DHX15 using anti-DHX15 antibody.

IHC analysis of DHX15 using anti-DHX15 antibody.