You have no items in your shopping cart.
Cart summary
DHODH Protein, Human, Recombinant (His)
Catalog Number: orb1978689
| Catalog Number | orb1978689 |
|---|---|
| Category | Proteins |
| Description | Catalyzes the conversion of dihydroorotate to orotate with quinone as electron acceptor. |
| Tag | N-10xHis |
| Purity | 85.00% |
| MW | 45.1 kDa (predicted) |
| UniProt ID | Q02127 |
| Protein Sequence | TGDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR |
| Expression System | E. coli |
| Biological Origin | Human |
| Biological Activity | Catalyzes the conversion of dihydroorotate to orotate with quinone as electron acceptor. |
| Expression Region | 31-395 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
