DHODH Antibody

• Catalog Number: orb381058
• Category: Antibodies
• Description: DHODH Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human DHODH (132-173aa RVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTE D), different from the related mouse sequence by four amino acids, and from the related rat sequence by two amino acids.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 42867 MW
• UniProt ID: Q02127
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Dihydroorotate dehydrogenase (quinone), mitochondr
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

WB analysis of DHODH using anti-DHODH antibody.Lane 1:rat liver tissue; 2:mouse spleen tissue; 3:HEPG2 cell.

IHC analysis of DHODH using anti-DHODH antibody. DHODH was detected in a paraffin-embedded section of mouse intestine tissue.

IHC analysis of DHODH using anti-DHODH antibody. DHODH was detected in a paraffin-embedded section of rat intestine tissue.

IHC analysis of DHODH using anti-DHODH antibody. DHODH was detected in a paraffin-embedded section of human lung cancer tissue.