You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2293639 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant DHFR. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG2a Kappa |
Conjugation | Unconjugated |
Reactivity | Human, Rat |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | DHFR (AAH03584, 88 a.a. ~ 187 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | HFLSRSLDDALKLTEQPELANKVDMVWIVGGSSVYKEAMNHPGHLKLFVTRIMQDFESDTFFPEIDLEKYKLLPEYPGVLSDVQEEKGIKYKFEVYEKND |
Tested applications | ELISA, IF, WB |
Clone Number | 2B10 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | AAH03584 |
Detection limit for recombinant GST tagged DHFR is approximately 0.1 ng/ml as a capture antibody.
DHFR monoclonal antibody (M01), clone 2B10 Western Blot analysis of DHFR expression in HeLa.
DHFR monoclonal antibody (M01), clone 2B10. Western Blot analysis of DHFR expression in PC-12.
Immunofluorescence of monoclonal antibody to DHFR on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot analysis of DHFR expression in transfected 293T cell line by DHFR monoclonal antibody (M01), clone 2B10. Lane 1: DHFR transfected lysate (21.5 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (36.74 KDa).