DHFR monoclonal antibody (M01), clone 2B10

• Catalog Number: orb2293639
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant DHFR.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2a Kappa
• Conjugation: Unconjugated
• Reactivity: Human, Rat
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: DHFR (AAH03584, 88 a.a. ~ 187 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: HFLSRSLDDALKLTEQPELANKVDMVWIVGGSSVYKEAMNHPGHLKLFVTRIMQDFESDTFFPEIDLEKYKLLPEYPGVLSDVQEEKGIKYKFEVYEKND
• Tested applications: ELISA, IF, WB
• Clone Number: 2B10
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: AAH03584

Detection limit for recombinant GST tagged DHFR is approximately 0.1 ng/ml as a capture antibody.

DHFR monoclonal antibody (M01), clone 2B10 Western Blot analysis of DHFR expression in HeLa.

DHFR monoclonal antibody (M01), clone 2B10. Western Blot analysis of DHFR expression in PC-12.

Immunofluorescence of monoclonal antibody to DHFR on HeLa cell. [antibody concentration 10 ug/ml]

Western Blot analysis of DHFR expression in transfected 293T cell line by DHFR monoclonal antibody (M01), clone 2B10. Lane 1: DHFR transfected lysate (21.5 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.74 KDa).