You have no items in your shopping cart.
Cart summary
DHDH Recombinant Protein (Human)
Catalog Number: orb2051520
| Catalog Number | orb2051520 |
|---|---|
| Category | Proteins |
| Description | DHDH Recombinant Protein (Human) |
| Tag | N-terminal GST-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 63.4 kDa |
| UniProt ID | Q9UQ10 |
| Protein Sequence | MALRWGIVSVGLISSDFTAVLQTLPRSEHQVVAVAARDLSRAKEFAQKHDIPKAYGSYEELAKDPSVEVAYIGTQHPQHKAAVMLCLAAGKAVLCEKPTGVNAAEVREMVAEARSRALFLMEAIWTRFFPASEALRSVLAQGTLGDLRVARAEFGKNLIHVPRAVDRAQAGGALLDIGIYCVQFTSMVFGGQKPEKISVVGRRHETGVDDTVTVLLQYPGEVHGSFTCSITVQLSNTASVSGTKGMVQLLNPCWCPTELVVKGEHKEFPLPPVPKDCNFDNGAGMSYEAKHVWECLRKGMKESPVIPLSESELLADILEEVRKAIGVTFPQDKR |
| Source | E.coli |
| NCBI | NP_055290 |
| Storage | -20°C or -80°C |
| Buffer/Preservatives | Liquid or Lyophilized powder |
| Alternative names | 2DD;3-deoxyglucosone reductase;dihydrodiol dehydro Read more... |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
Human DHDH protein [orb54393]
Greater than 90% as determined by SDS-PAGE.
63.4 kDa
E.coli
20 μg, 100 μg, 1 mgDHDH Recombinant Protein (Human) [orb2051518]
Greater than 90% as determined by SDS-PAGE.
63.4 kDa
E.coli
20 μgDHDH Recombinant Protein (Human) [orb2051519]
Greater than 90% as determined by SDS-PAGE.
63.4 kDa
E.coli
1 mg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars
