DGUOK monoclonal antibody (M02), clone 3E9

• Catalog Number: orb2293647
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant DGUOK.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3E9
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: DGUOK (NP_001920, 1 a.a. ~ 89 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MAAGRLFLSRLRAPFSSMAKSPLEGVSSSRGLHAGRGPRRLSIEGNIGLHCPKSWKLAGYDVPGASTMVLHIPDIFLFEPPESTAGALP
• NCBI: NP_001920
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western Blot analysis of DGUOK expression in transfected 293T cell line by DGUOK monoclonal antibody (M02), clone 3E9. Lane 1: DGUOK transfected lysate (32.056 KDa). Lane 2: Non-transfected lysate.

Western blot analysis of DGUOK over-expressed 293 cell line, cotransfected with DGUOK Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with DGUOK monoclonal antibody (M02), clone 3E9 (Cat # orb2293647). GAPDH (36.1 kDa) used as specificity and loading control.

Western Blot detection against Immunogen (35.53 KDa).