DFFA monoclonal antibody (M05), clone 3A11

• Catalog Number: orb2293658
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant DFFA.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3A11
• Tested applications: ELISA, PLA, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: DFFA (NP_004392.1, 231 a.a. ~ 331 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: TSSDVALASHILTALREKQAPELSLSSQDLELVTKEDPKALAVALNWDIKKTETVQEACERELALRLQQTQSLHSLRSISASKASPPGDLQNPKRARQDPT
• NCBI: NP_004392.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged DFFA is 0.1 ng/ml as a capture antibody.

Proximity Ligation Analysis of protein-protein interactions between CASP3 and DFFA. HeLa cells were stained with anti-CASP3 rabbit purified polyclonal 1:1200 and anti-DFFA mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

Western Blot analysis of DFFA expression in transfected 293T cell line by DFFA monoclonal antibody (M05), clone 3A11. Lane 1: DFFA transfected lysate (Predicted MW: 36.5 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.85 KDa).