DENR monoclonal antibody (M01), clone 1H3

• Catalog Number: orb2291871
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant DENR.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1H3
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: DENR (NP_003668, 1 a.a. ~ 81 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MAADISESSGADCKGDPRNSAKLDADYPLRVLYCGVCSLPTEYCEYMPDVAKCRQWLEKNFPNEFAKLTVENSPKQEAGIS
• NCBI: NP_003668
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western Blot analysis of DENR expression in transfected 293T cell line by DENR monoclonal antibody (M01), clone 1H3. Lane 1: DENR transfected lysate (22.092 KDa). Lane 2: Non-transfected lysate.

Western blot analysis of DENR over-expressed 293 cell line, cotransfected with DENR Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with DENR monoclonal antibody (M01), clone 1H3 (Cat # orb2291871). GAPDH (36.1 kDa) used as specificity and loading control.

Western Blot detection against Immunogen (34.65 KDa).