You have no items in your shopping cart.
Cart summary
DEFB130 MORE Recombinant Protein (Human)
Catalog Number: orb2053061
| Catalog Number | orb2053061 |
|---|---|
| Category | Proteins |
| Description | DEFB130 MORE Recombinant Protein (Human) |
| Tag | N-terminal 6xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 8.3 kDa |
| UniProt ID | Q30KQ2 |
| Protein Sequence | GVIPGQKQCIALKGVCRDKLCSTLDDTIGICNEGKKCCRRWWILEPYPTPVPKGKSP |
| Source | Yeast |
| Storage | -20°C or -80°C |
| Buffer/Preservatives | Liquid or Lyophilized powder |
| Alternative names | beta-defensin 130;beta-defensin 130A;beta-defensin Read more... |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
DEFB130 MORE Recombinant Protein (Human) [orb2053062]
Greater than 90% as determined by SDS-PAGE.
8.3 kDa
Yeast
20 μgDEFB130 MORE Recombinant Protein (Human) [orb2053063]
Greater than 90% as determined by SDS-PAGE.
8.3 kDa
Yeast
100 μg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars
