You have no items in your shopping cart.
Cart summary
DEFB128 Protein, Human, Recombinant (His & Myc)
Catalog Number: orb1978909
| Catalog Number | orb1978909 |
|---|---|
| Category | Proteins |
| Description | Has antibacterial activity. DEFB128 Protein, Human, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 16.0 kDa and the accession number is Q7Z7B8. |
| Tag | N-10xHis, C-Myc |
| Purity | 98.00% |
| MW | 16.0 kDa (predicted) |
| UniProt ID | Q7Z7B8 |
| Protein Sequence | ARLKKCFNKVTGYCRKKCKVGERYEIGCLSGKLCCANDEEEKKHVSFKKPHQHSGEKLSVLQDYIILPTITIFTV |
| Expression System | E. coli |
| Biological Origin | Human |
| Biological Activity | Has antibacterial activity. DEFB128 Protein, Human, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 16.0 kDa and the accession number is Q7Z7B8. |
| Expression Region | 19-93 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Expiration Date | 6 months from date of receipt. |
