You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1976772 |
---|---|
Category | Proteins |
Description | DEFB126 Protein, Pongo pygmaeus, Recombinant (GST) is expressed in yeast with N-GST tag. The predicted molecular weight is 31.9 kDa and the accession number is A4H244. |
Tag | N-GST |
Purity | 98.00% |
MW | 31.9 kDa (predicted) |
UniProt ID | A4H244 |
Protein Sequence | SWYVKKCLNDVGICKKKCKPEELHVKNGWAMCGKQRDCCVPAD |
Expression System | P. pastoris (Yeast) |
Biological Origin | Pongo pygmaeus |
Biological Activity | DEFB126 Protein, Pongo pygmaeus, Recombinant (GST) is expressed in yeast with N-GST tag. The predicted molecular weight is 31.9 kDa and the accession number is A4H244. |
Expression Region | 21-63 aa |
Storage | -20°C |
Note | For research use only |
Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Expiration Date | 6 months from date of receipt. |