You have no items in your shopping cart.
Cart summary
DEFB126 Protein, Pongo pygmaeus, Recombinant (GST)
Catalog Number: orb1976772
| Catalog Number | orb1976772 |
|---|---|
| Category | Proteins |
| Description | DEFB126 Protein, Pongo pygmaeus, Recombinant (GST) is expressed in yeast with N-GST tag. The predicted molecular weight is 31.9 kDa and the accession number is A4H244. |
| Tag | N-GST |
| Purity | 98.00% |
| MW | 31.9 kDa (predicted) |
| UniProt ID | A4H244 |
| Protein Sequence | SWYVKKCLNDVGICKKKCKPEELHVKNGWAMCGKQRDCCVPAD |
| Expression System | P. pastoris (Yeast) |
| Biological Origin | Pongo pygmaeus |
| Biological Activity | DEFB126 Protein, Pongo pygmaeus, Recombinant (GST) is expressed in yeast with N-GST tag. The predicted molecular weight is 31.9 kDa and the accession number is A4H244. |
| Expression Region | 21-63 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
