You have no items in your shopping cart.
Cart summary
DEFA1 Protein, Human, Recombinant (GST)
Catalog Number: orb1978144
| Catalog Number | orb1978144 |
|---|---|
| Category | Proteins |
| Description | Defensin 1 and defensin 2 have antibacterial, fungicide and antiviral activities. Has antimicrobial activity against Gram-negative and Gram-positive bacteria. Defensins are thought to kill microbes by permeabilizing their plasma membrane. DEFA1 Protein, Human, Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 37.2 kDa and the accession number is P59665. |
| Tag | N-GST |
| Purity | 98.00% |
| MW | 37.2 kDa (predicted) |
| UniProt ID | P59665 |
| Protein Sequence | DIPEVVVSLAWDESLAPKHPGSRKNMACYCRIPACIAGERRYGTCIYQGRLWAFCC |
| Expression System | E. coli |
| Biological Origin | Human |
| Biological Activity | Defensin 1 and defensin 2 have antibacterial, fungicide and antiviral activities. Has antimicrobial activity against Gram-negative and Gram-positive bacteria. Defensins are thought to kill microbes by permeabilizing their plasma membrane. DEFA1 Protein, Human, Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 37.2 kDa and the accession number is P59665. |
| Expression Region | 1-94 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
- Item 1 of 1
