You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2291087 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant DDX56. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG1 Kappa |
Conjugation | Unconjugated |
Reactivity | Human, Mouse, Rat |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | DDX56 (NP_061955, 450 a.a. ~ 547 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | IKEELLHSEKLKTYFEDNPRDLQLLRHDLPLHPAVVKPHLGHVPDYLVPPALRGLVRPHKKRKKLSSSCRKAKRAKSQNPLRSFKHKGKKFRPTAKPS |
Tested applications | ELISA, WB |
Clone Number | 6B9 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_061955 |
DDX56 monoclonal antibody (M03), clone 6B9. Western Blot analysis of DDX56 expression in HeLa.
DDX56 monoclonal antibody (M03), clone 6B9. Western Blot analysis of DDX56 expression in HepG2.
DDX56 monoclonal antibody (M03), clone 6B9. Western Blot analysis of DDX56 expression in NIH/3T3.
DDX56 monoclonal antibody (M03), clone 6B9. Western Blot analysis of DDX56 expression in PC-12.
DDX56 monoclonal antibody (M03), clone 6B9. Western Blot analysis of DDX56 expression in Raw 264.7.
Detection limit for recombinant GST tagged DDX56 is 0.1 ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.52 KDa).