DDX41 monoclonal antibody (M01), clone 2F4

• Catalog Number: orb2291139
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant DDX41.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2F4
• Tested applications: ELISA, IF, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: DDX41 (NP_057306, 523 a.a. ~ 622 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: TGRSGNTGIATTFINKACDESVLMDLKALLLEAKQKVPPVLQVLHCGDESMLDIGGERGCAFCGGLGHRITDCPKLEAMQTKQVSNIGRKDYLAHSSMDF
• NCBI: NP_057306
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

DDX41 monoclonal antibody (M01), clone 2F4. Western Blot analysis of DDX41 expression in HeLa.

Detection limit for recombinant GST tagged DDX41 is approximately 0.3 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to DDX41 on HeLa cell. [antibody concentration 10 ug/ml]

Western Blot analysis of DDX41 expression in transfected 293T cell line by DDX41 monoclonal antibody (M01), clone 2F4. Lane 1: DDX41 transfected lysate(70 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.74 KDa).