DDX3/DEAD-box Protein 3 Antibody (Phospho-Thr322)

• Catalog Number: orb2240575
• Category: Antibodies
• Description: DDX3/DEAD-box Protein 3 Antibody (Phospho-Thr322)
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: ELISA, ICC, IF, IHC-P
• Immunogen: The antiserum was produced against synthesized peptide derived from human DDX3/DEAD-box Protein 3 around the phosphorylation site of Thr322.
• Conjugation: Unconjugated
• MW: 73 kDa
• UniProt ID: O00571
• Protein Sequence: Synthetic peptide located within the following region: YACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVIN
• Storage: -20°C
• Alternative names: ATP-dependent RNA helicase DDX3X;CAP-Rf;DBX;DDX14;
• Note: For research use only
• Application notes: Application Info: IHC: 1:50~1:100IF: 1:100~1:500ELISA: 1:1000
• Expiration Date: 12 months from date of receipt.