DDT purified MaxPab rabbit polyclonal antibody (D01P)

• Catalog Number: orb2293690
• Category: Antibodies
• Description: Rabbit polyclonal antibody raised against a full-length human DDT protein.
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Reactivity: Human
• Immunogen: DDT (NP_001346.1, 1 a.a. ~ 118 a.a) full-length human protein.
• Conjugation: Unconjugated
• Protein Sequence: MPFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIGVVGTAEDNRSHSAHFFEFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFL
• NCBI: NP_001346.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

DDT MaxPab rabbit polyclonal antibody. Western Blot analysis of DDT expression in human spleen.

Western Blot analysis of DDT expression in transfected 293T cell line by DDT MaxPab polyclonal antibody. Lane 1: DDT transfected lysate (12.70 KDa). Lane 2: Non-transfected lysate.