DDT Antibody

• Catalog Number: orb443173
• Category: Antibodies
• Description: DDT Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: FC, ICC, IF, IHC, WB
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence of human DDT (EFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFL).
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml Immunocytochemistry/Immunofluorescence, 2μg/ml Flow Cytometry, 1-3μg/1x106 cells
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 14 kDa
• UniProt ID: P30046
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: D-dopachrome decarboxylase; D-dopachrome tautomera
• Note: For research use only
• Application notes: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

Flow Cytometry analysis of U20S cells using anti-DDT antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

WB analysis of DDT using anti-DDT antibody.Lane 1:human HL-60 Cell;2:rat liver tissue;3:mouse liver tissue.

IF analysis of DDT using anti-DDT antibody. DDT was detected in immunocytochemical section of U20S cells.

IHC analysis of DDT using anti-DDT antibody.DDT was detected in paraffin-embedded section of human cholangiocarcinoma tissue.

IHC analysis of DDT using anti-DDT antibody.DDT was detected in paraffin-embedded section of human intestinal cancer tissue.

IHC analysis of DDT using anti-DDT antibody.DDT was detected in paraffin-embedded section of human lung cancer tissue.

IHC analysis of DDT using anti-DDT antibody.DDT was detected in paraffin-embedded section of human placenta tissue.

IHC analysis of DDT using anti-DDT antibody.DDT was detected in paraffin-embedded section of human ovary cancer tissue.

IHC analysis of DDT using anti-DDT antibody.DDT was detected in paraffin-embedded section of rat brain tissue.

IHC analysis of DDT using anti-DDT antibody.DDT was detected in paraffin-embedded section of rat spleen tissue.

IHC analysis of DDT using anti-DDT antibody.DDT was detected in paraffin-embedded section of human tonsil tissue.

IHC analysis of DDT using anti-DDT antibody.DDT was detected in paraffin-embedded section of mouse spleen tissue.

IHC analysis of DDT using anti-DDT antibody.DDT was detected in paraffin-embedded section of mouse small intestine tissue.