DDOST monoclonal antibody (M06), clone 2D7

• Catalog Number: orb2293692
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant DDOST.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2D7
• Tested applications: ELISA, IF, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: DDOST (NP_005207, 328 a.a. ~ 427 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: TDLVEYSIVIQQLSNGKWVPFDGDDIQLEFVRIDPFVRTFLKKKGGKYSVQFKLPDVYGVFQFKVDYNRLGYTHLYSSTQVSVRPLQHTQYERFIPSAYP
• NCBI: NP_005207
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

DDOST monoclonal antibody (M06), clone 2D7. Western Blot analysis of DDOST expression in COLO 320 HSR.

DDOST monoclonal antibody (M06), clone 2D7. Western Blot analysis of DDOST expression in HepG2.

DDOST monoclonal antibody (M06), clone 2D7. Western Blot analysis of DDOST expression in human stomach.

Detection limit for recombinant GST tagged DDOST is 1 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to DDOST on HeLa cell. [antibody concentration 10 ug/ml]