You have no items in your shopping cart.
Cart summary
Item 1 of 1
DCTD purified MaxPab rabbit polyclonal antibody (D01P)
Catalog Number: orb2293732
| Catalog Number | orb2293732 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody raised against a full-length human DCTD protein. |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | WB |
| Reactivity | Human |
| Immunogen | DCTD (NP_001012750.1, 1 a.a. ~ 189 a.a) full-length human protein. |
| Conjugation | Unconjugated |
| Protein Sequence | MVGGGQPCGPNMSEVSCKKRDDYLEWPEYFMAVAFLSAQRSKDPNSQVGACIVNSENKIVGIGYNGMPNGCSDDVLPWRRTAENKLDTKYPYVCHAELNAIMNKNSTDVKGCSMYVALFPCNECAKLIIQAGIKEVIFMSDKYHDSDEATAARLLFNMAGVTFRKFIPKCSKIVIDFDSINSRPSQKLQ |
| NCBI | NP_001012750.1 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | In 1x PBS, pH 7.4 |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
Western Blot analysis of DCTD expression in transfected 293T cell line by DCTD MaxPab polyclonal antibody. Lane 1: DCTD transfected lysate (21.00 KDa). Lane 2: Non-transfected lysate.
