DCTD monoclonal antibody (M01), clone 4B9

• Catalog Number: orb2293731
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant DCTD.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 4B9
• Tested applications: ELISA, IHC-P, WB
• Reactivity: Human
• Isotype: IgG3 Kappa
• Immunogen: DCTD (NP_001912.2, 69 a.a. ~ 178 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: RTAENKLDTKYPYVCHAELNAIMNKNSTDVKGCSMYVALFPCNECAKLIIQAGIKEVIFMSDKYHDSDEATAARLLFNMAGVTFRKFIPKCSKIVIDFDSINSRPSQKLQ
• NCBI: NP_001912.2
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged DCTD is 0.03 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to DCTD on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]

Western Blot analysis of DCTD expression in transfected 293T cell line by DCTD monoclonal antibody (M01), clone 4B9. Lane 1: DCTD transfected lysate (20.016 KDa). Lane 2: Non-transfected lysate.

Western blot analysis of DCTD over-expressed 293 cell line, cotransfected with DCTD Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with DCTD monoclonal antibody (M01), clone 4B9 (Cat # orb2293731). GAPDH (36.1 kDa) used as specificity and loading control.

Western Blot detection against Immunogen (37.84 KDa).