DBT purified MaxPab rabbit polyclonal antibody (D01P)

• Catalog Number: orb2293755
• Category: Antibodies
• Description: Rabbit polyclonal antibody raised against a full-length human DBT protein.
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Reactivity: Human
• Immunogen: DBT (AAH16675.1, 1 a.a. ~ 482 a.a) full-length human protein.
• Conjugation: Unconjugated
• Protein Sequence: MAAVRMLRTWSRNAGKLICVRYFQTCGNVHVLKPNYVCFFGYPSFKYSHPHHFLKTTAALRGQVVQFKLSDIGEGIREVTVKEWYVKEGDTVSQFDSICEVQSDKASVTITSRYDGVIKKLYYNLDDIAYVGKPLVDIETEALKDSEEDVVETPAVSHDEHTHQEIKGRKTLATPAVRRLAMENNIKLSEVVGSGKDGRILKEDILNYLEKQTGAILPPSPKVEIMPPPPKPKDMTVPILVSKPPVFTGKDKTEPIKGFQKAMVKTMSAALKIPHFGYCDEIDLTELVKLREELKPIAFARGIKLSFMPFFLKAASLGLLQFPILNASVDENCQNITYKASHNIGIAMDTEQGLIVPNVKNVQICSIFDIATELNRLQKLGSVGQLSTTDLTGGTFTLSNIGSIGGTFAKPVIMPPEVAIGALGSIKAIPRFNQKGEVYKAQIMNVSWSADHRVIDGATMSRFSNLWKSYLENPAFMLLDLK
• NCBI: AAH16675.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

DBT MaxPab rabbit polyclonal antibody. Western Blot analysis of DBT expression in A-431.

DBT MaxPab rabbit polyclonal antibody. Western Blot analysis of DBT expression in human kidney.

Western Blot analysis of DBT expression in transfected 293T cell line by DBT MaxPab polyclonal antibody. Lane 1: DBT transfected lysate (53.50 KDa). Lane 2: Non-transfected lysate.