You have no items in your shopping cart.
Cart summary
Item 1 of 2
Item 1 of 2
DAPK1 monoclonal antibody (M01), clone 2E7
Catalog Number: orb2293780
| Catalog Number | orb2293780 |
|---|---|
| Category | Antibodies |
| Description | Mouse monoclonal antibody raised against a partial recombinant DAPK1. |
| Clonality | Monoclonal |
| Species/Host | Mouse |
| Isotype | IgG1 kappa |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Buffer/Preservatives | In 1x PBS, pH 7.4 |
| Immunogen | DAPK1 (NP_004929, 1211 a.a. ~ 1310 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Protein Sequence | LLLDSVCSTIENVMATTLPGLLTVKHYLSPQQLREHHEPVMIYQPRDFFRAQTLKETSLTNTMGGYKESFSSIMCFGCHDVYSQASLGMDIHASDLNLLT |
| Tested applications | ELISA, PLA |
| Clone Number | 2E7 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Note | For research use only |
| NCBI | NP_004929 |
Detection limit for recombinant GST tagged DAPK1 is approximately 0.1 ng/ml as a capture antibody.
Proximity Ligation Analysis of protein-protein interactions between MAPK3 and DAPK1. HeLa cells were stained with anti-MAPK3 rabbit purified polyclonal 1:1200 and anti-DAPK1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
