DAF monoclonal antibody (M01), clone 1G3

• Catalog Number: orb2293794
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant DAF.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1G3
• Tested applications: ELISA, PLA, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: DAF (NP_000565, 35 a.a. ~ 134 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: DCGLPPDVPNAQPALEGRTSFPEDTVITYKCEESFVKIPGEKDSVICLRGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFPVGTVVEYECRPGYR
• NCBI: NP_000565
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

DAF monoclonal antibody (M01), clone 1G3 Western Blot analysis of DAF expression in HeLa.

Detection limit for recombinant GST tagged DAF is approximately 0.03 ng/ml as a capture antibody.

Proximity Ligation Analysis of protein-protein interactions between LCK and CD55. HeLa cells were stained with anti-LCK rabbit purified polyclonal 1:1200 and anti-CD55 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

Western Blot analysis of CD55 expression in transfected 293T cell line by DAF monoclonal antibody (M01), clone 1G3. Lane 1: CD55 transfected lysate (41.4 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.74 KDa).