You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2291369 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant DAAM1. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 5D3 |
Tested applications | ELISA, WB |
Reactivity | Human, Rat |
Isotype | IgG2a Kappa |
Immunogen | DAAM1 (NP_055807, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | MAPRKRGGRGISFIFCCFRNNDHPEITYRLRNDSNFALQTMEPALPMPPVEELDVMFSELVDELDLTDKHREAMFALPAEKKWQIYCSKKKDQEENKGATSWPEFYIDQL |
NCBI | NP_055807 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
DAAM1 monoclonal antibody (M05), clone 5D3 Western Blot analysis of DAAM1 expression in A-431.
DAAM1 monoclonal antibody (M05), clone 5D3. Western Blot analysis of DAAM1 expression in PC-12.
Detection limit for recombinant GST tagged DAAM1 is approximately 0.03 ng/ml as a capture antibody.
Western Blot analysis of DAAM1 expression in transfected 293T cell line by DAAM1 monoclonal antibody (M05), clone 5D3. Lane 1: DAAM1 transfected lysate(122 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (37.84 KDa).