DAAM1 monoclonal antibody (M05), clone 5D3

• Catalog Number: orb2291369
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant DAAM1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 5D3
• Tested applications: ELISA, WB
• Reactivity: Human, Rat
• Isotype: IgG2a Kappa
• Immunogen: DAAM1 (NP_055807, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MAPRKRGGRGISFIFCCFRNNDHPEITYRLRNDSNFALQTMEPALPMPPVEELDVMFSELVDELDLTDKHREAMFALPAEKKWQIYCSKKKDQEENKGATSWPEFYIDQL
• NCBI: NP_055807
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

DAAM1 monoclonal antibody (M05), clone 5D3 Western Blot analysis of DAAM1 expression in A-431.

DAAM1 monoclonal antibody (M05), clone 5D3. Western Blot analysis of DAAM1 expression in PC-12.

Detection limit for recombinant GST tagged DAAM1 is approximately 0.03 ng/ml as a capture antibody.

Western Blot analysis of DAAM1 expression in transfected 293T cell line by DAAM1 monoclonal antibody (M05), clone 5D3. Lane 1: DAAM1 transfected lysate(122 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (37.84 KDa).