You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb333729 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to Cytokeratin 3 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Human, Rabbit |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human KRT3 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 64kDa |
Target | KRT3 |
UniProt ID | P12035 |
Protein Sequence | Synthetic peptide located within the following region: GSSGFSGGSGFGSISGARYGVSGGGFSSASNRGGSIKFSQSSQSSQRYSR |
NCBI | NP_476429 |
Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti CK 3 antibody, anti CK-3 antibody, anti CK3 a Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of human brain tissue using Cytokeratin 3 antibody
IHC-P | |
Mouse | |
Human, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC-Fr, IHC-P | |
Canine, Human, Rabbit, Rat | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating