Cytochrome P450 Reductase/POR Antibody

• Catalog Number: orb316599
• Category: Antibodies
• Description: Cytochrome P450 Reductase/POR Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: FC, ICC, IHC, WB
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human POR (633-668aa RNMARDVQNTFYDIVAELGAMEHAQAVDYIKKLMTK), different from the related mouse and rat sequences by five amino acids.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat Western blot, 0.1-0.5μg/ml, Human, Mouse, RatImmunohistochemistry (Frozen Section), 0.5-1μg/ml, Human Immunocytochemistry, 0.5-1μg/ml, Human Flow Cytometry, 1-3μg/1x106 cells, Human
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 76690 MW
• UniProt ID: P16435
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: NADPH--cytochrome P450 reductase;CPR;P450R;1.6.2.4
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

Flow Cytometry analysis of K562 cells using anti-POR antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

Flow Cytometry analysis of A549 cells using anti-POR antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

Flow Cytometry analysis of SiHa cells using anti-POR antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

WB analysis of POR using anti-POR antibody.Lane 1:human placenta tissue; 2:human HepG2 cell; 3:human CACO-2 cell; 4:human K562 cell; 5:rat kidney tissue; 6:rat liver tissue; 7:mouse kidney tissue; 8:mouse liver tissue.

IHC analysis of POR using anti-POR antibody. POR was detected in paraffin-embedded section of Human Mammary Cancer Tissue.

IHC analysis of POR using anti-POR antibody. POR was detected in paraffin-embedded section of Rat Intestine Tissue.

IHC analysis of POR using anti-POR antibody. POR was detected in paraffin-embedded section of Mouse Intestine Tissue.