Cytochrome P450 2D6/CYP2D6 Antibody

• Catalog Number: orb18722
• Category: Antibodies
• Description: Cytochrome P450 2D6/CYP2D6 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Cytochrome P450 2D6 (315-347aa AWGLLLMILHPDVQRRVQQEIDDVIGQVRRPEM).
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat Western blot, 0.1-0.5μg/ml, Mouse, Rat, Human
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 55769 MW
• UniProt ID: P10635
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Cytochrome P450 2D6;1.14.14.1;CYPIID6;Cytochrome P
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

WB analysis of Cytochrome P450 2D6 using anti-Cytochrome P450 2D6 antibody.Lane 1:rat liver tissue;2:mouse liver tissue.

IHC analysis of Cytochrome P450 2D6 using anti-Cytochrome P450 2D6 antibody. Cytochrome P450 2D6 was detected in paraffin-embedded section of rat intestine tissues.

IHC analysis of Cytochrome P450 2D6 using anti-Cytochrome P450 2D6 antibody. Cytochrome P450 2D6 was detected in paraffin-embedded section of mouse liver tissues.

IHC analysis of Cytochrome P450 2D6 using anti-Cytochrome P450 2D6 antibody. Cytochrome P450 2D6 was detected in paraffin-embedded section of human liver cancer tissues.

IHC analysis of Cytochrome P450 2D6 using anti-Cytochrome P450 2D6 antibody. Cytochrome P450 2D6 was detected in paraffin-embedded section of mouse intestine tissues.