You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb18722 |
---|---|
Category | Antibodies |
Description | Cytochrome P450 2D6/CYP2D6 Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Reactivity | Human, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human Cytochrome P450 2D6 (315-347aa AWGLLLMILHPDVQRRVQQEIDDVIGQVRRPEM). |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Dilution range | Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat Western blot, 0.1-0.5μg/ml, Mouse, Rat, Human |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 55769 MW |
UniProt ID | P10635 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Cytochrome P450 2D6;1.14.14.1;CYPIID6;Cytochrome P Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
WB analysis of Cytochrome P450 2D6 using anti-Cytochrome P450 2D6 antibody.Lane 1:rat liver tissue;2:mouse liver tissue.
IHC analysis of Cytochrome P450 2D6 using anti-Cytochrome P450 2D6 antibody. Cytochrome P450 2D6 was detected in paraffin-embedded section of rat intestine tissues.
IHC analysis of Cytochrome P450 2D6 using anti-Cytochrome P450 2D6 antibody. Cytochrome P450 2D6 was detected in paraffin-embedded section of mouse liver tissues.
IHC analysis of Cytochrome P450 2D6 using anti-Cytochrome P450 2D6 antibody. Cytochrome P450 2D6 was detected in paraffin-embedded section of human liver cancer tissues.
IHC analysis of Cytochrome P450 2D6 using anti-Cytochrome P450 2D6 antibody. Cytochrome P450 2D6 was detected in paraffin-embedded section of mouse intestine tissues.
FC, ICC, IF, IHC, WB | |
Human | |
Rabbit | |
Monoclonal | |
Unconjugated |
Filter by Rating