CYTH2 monoclonal antibody (M02), clone 6H5

• Catalog Number: orb2291744
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant CYTH2.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 6H5
• Tested applications: ELISA, IF, IHC-P, WB
• Reactivity: Human, Rat
• Isotype: IgG2a Kappa
• Immunogen: CYTH2 (NP_059431, 314 a.a. ~ 398 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: VDDPRKPNCFELYIPNNKGQLIKACKTEADGRVVEGNHMVYRISAPTQEEKDEWIKSIQAAVSVDPFYEMLAARKKRISVKKKQE
• NCBI: NP_059431
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

CYTH2 monoclonal antibody (M02), clone 6H5 Western Blot analysis of CYTH2 expression in PC-12.

Detection limit for recombinant GST tagged CYTH2 is approximately 0.03 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to CYTH2 on HeLa cell. [antibody concentration 10 ug/ml]

Immunoperoxidase of monoclonal antibody to CYTH2 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]

Western Blot analysis of CYTH2 expression in transfected 293T cell line by CYTH2 monoclonal antibody (M02), clone 6H5. Lane 1: CYTH2 transfected lysate (46.5 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (35.09 KDa).