You have no items in your shopping cart.
Cart summary
CYP4A11 Peptide - middle region
Catalog Number: orb1998817
| Catalog Number | orb1998817 |
|---|---|
| Category | Proteins |
| Description | CYP4A11 Peptide - middle region |
| Predicted Reactivity | Human |
| Form/Appearance | Lyophilized powder |
| MW | 57 kDa |
| UniProt ID | Q02928 |
| Protein Sequence | Synthetic peptide located within the following region: MKCAFSHQGSIQVDRNSQSYIQAISDLNNLVFSRVRNAFHQNDTIYSLTS |
| NCBI | NP_000769.2 |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Buffer/Preservatives | Lyophilized powder |
| Alternative names | CP4Y, CYP4A2, CYP4AII Read more... |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
