You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2001618 |
---|---|
Category | Proteins |
Description | CYP3A4 Peptide - N-terminal region |
Predicted Reactivity | Human |
Form/Appearance | Lyophilized powder |
Buffer/Preservatives | Lyophilized powder |
Protein Sequence | Synthetic peptide located within the following region: LFKKLGIPGPTPLPFLGNILSYHKGFCMFDMECHKKYGKVWGFYDGQQPV |
UniProt ID | P08684 |
MW | 57 kDa |
Tested applications | WB |
Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
Alternative names | HLP, CP33, CP34, CYP3A, NF-25, CYP3A3, P450C3, CYP Read more... |
Note | For research use only |
NCBI | NP_001189784.1 |