You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2011054 |
---|---|
Category | Proteins |
Description | CYP3A4 Peptide - middle region |
Predicted Reactivity | Human |
Form/Appearance | Lyophilized powder |
Buffer/Preservatives | Lyophilized powder |
Protein Sequence | KSVKRMKESRLEDTQKHRVDFLQLMIDSQNSKETESHKALSDLELVAQSI |
UniProt ID | P08684 |
MW | 57kDa |
Tested applications | WB |
Application notes | This is a synthetic peptide designed for use in combination with CYP3A4 Rabbit Polyclonal Antibody (orb581359). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. |
Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
Alternative names | CP33, CP34, CYP3A, CYP3A3, HLP, MGC126680, NF-25, Read more... |
Note | For research use only |
NCBI | NP_059488 |