You have no items in your shopping cart.
Cart summary
CYP3A4 Peptide - middle region
Catalog Number: orb2011054
| Catalog Number | orb2011054 |
|---|---|
| Category | Proteins |
| Description | CYP3A4 Peptide - middle region |
| Predicted Reactivity | Human |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized powder |
| Protein Sequence | KSVKRMKESRLEDTQKHRVDFLQLMIDSQNSKETESHKALSDLELVAQSI |
| UniProt ID | P08684 |
| MW | 57kDa |
| Tested applications | WB |
| Application notes | This is a synthetic peptide designed for use in combination with CYP3A4 Rabbit Polyclonal Antibody (orb581359). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Alternative names | CP33, CP34, CYP3A, CYP3A3, HLP, MGC126680, NF-25, Read more... |
| Note | For research use only |
| NCBI | NP_059488 |
