You have no items in your shopping cart.
Cart summary
CYP26B1 Peptide - middle region
Catalog Number: orb2000327
| Catalog Number | orb2000327 |
|---|---|
| Category | Proteins |
| Description | CYP26B1 Peptide - middle region |
| Predicted Reactivity | Human |
| Form/Appearance | Lyophilized powder |
| MW | 56 kDa |
| UniProt ID | Q9NR63 |
| Protein Sequence | Synthetic peptide located within the following region: APVFKDVNVFDPDRFSQARSEDKDGRFHYLPFGGGVRTCLGKHLAKLFLK |
| NCBI | NP_001264671.1 |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Buffer/Preservatives | Lyophilized powder |
| Alternative names | RHFCA, CYP26A2, P450RAI2, P450RAI-2 Read more... |
| Note | For research use only |
| Application notes | This is a synthetic peptide designed for use in combination with CYP26B1 Rabbit Polyclonal Antibody (orb589697). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. |
| Expiration Date | 6 months from date of receipt. |
