CYP26B1 monoclonal antibody (M01), clone 1H6

• Catalog Number: orb2290977
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant CYP26B1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1H6
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: CYP26B1 (NP_063938, 131 a.a. ~ 230 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: SNSIGDIHRNKRKVFSKIFSHEALESYLPKIQLVIQDTLRAWSSHPEAINVYQEAQKLTFRMAIRVLLGFSIPEEDLGHLFEVYQQFVDNVFSLPVDLPF
• NCBI: NP_063938
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western Blot analysis of CYP26B1 expression in transfected 293T cell line by CYP26B1 monoclonal antibody (M01), clone 1H6. Lane 1: CYP26B1 transfected lysate (Predicted MW: 57.5 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.74 KDa).