You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2290977 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant CYP26B1. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 1H6 |
Tested applications | ELISA, WB |
Reactivity | Human |
Isotype | IgG2a Kappa |
Immunogen | CYP26B1 (NP_063938, 131 a.a. ~ 230 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | SNSIGDIHRNKRKVFSKIFSHEALESYLPKIQLVIQDTLRAWSSHPEAINVYQEAQKLTFRMAIRVLLGFSIPEEDLGHLFEVYQQFVDNVFSLPVDLPF |
NCBI | NP_063938 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Western Blot analysis of CYP26B1 expression in transfected 293T cell line by CYP26B1 monoclonal antibody (M01), clone 1H6. Lane 1: CYP26B1 transfected lysate (Predicted MW: 57.5 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (36.74 KDa).