CYGB monoclonal antibody (M02), clone 1A1

• Catalog Number: orb2290699
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant CYGB.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1A1
• Tested applications: ELISA, IF, IHC-P, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: CYGB (AAH29798, 1 a.a. ~ 190 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MEKVPGEMEIERRERSEELSEAERKAVQAMWARLYASCEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPLEMERSPQLRKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVVAEEFASDFPPETQRAWAKLRGLIYSHVTAAYKEVGWVQQVPNATTPPATLPSSGP
• NCBI: AAH29798
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged CYGB is approximately 1 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to CYGB on HeLa cell. [antibody concentration 10 ug/ml]

Immunoperoxidase of monoclonal antibody to CYGB on formalin-fixed paraffin-embedded human heart. [antibody concentration 3 ug/ml]

Western Blot analysis of CYGB expression in transfected 293T cell line by CYGB monoclonal antibody (M02), clone 1A1. Lane 1: CYGB transfected lysate(21 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (46.64 KDa).