You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2292202 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a full length recombinant CXCL5. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG1 Kappa |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | CXCL5 (AAH08376, 1 a.a. ~ 114 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | MSLLSSRAARVPGPSSSLCALLVLLLLLTQPGPIASAGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLRKVIQKILDGGNKEN |
Tested applications | ELISA, IHC-P, WB |
Clone Number | 2A9 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | AAH08376 |
Immunoperoxidase of monoclonal antibody to CXCL5 on formalin-fixed paraffin-embedded human smooth muscle. [antibody concentration 0.7 ug/ml]
Western Blot detection against Immunogen (38.28 KDa).