CXCL13 MaxPab rabbit polyclonal antibody (D01)

• Catalog Number: orb2291534
• Category: Antibodies
• Description: Rabbit polyclonal antibody raised against a full-length human CXCL13 protein.
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: No additive
• Immunogen: CXCL13 (NP_006410.1, 1 a.a. ~ 109 a.a) full-length human protein.
• Protein Sequence: MKFISTSLLLMLLVSSLSPVQGVLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRSSSTLPVPVFKRKIP
• Tested applications: IP, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_006410.1

Immunoprecipitation of CXCL13 transfected lysate using anti-CXCL13 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with CXCL13 MaxPab mouse polyclonal antibody (B02).

Western Blot analysis of CXCL13 expression in transfected 293T cell line by CXCL13 MaxPab polyclonal antibody. Lane 1: CXCL13 transfected lysate(12.7 KDa). Lane 2: Non-transfected lysate.