You have no items in your shopping cart.
Cart summary
CXCL10 Protein, Human, Recombinant (His)
Catalog Number: orb2300329
| Catalog Number | orb2300329 |
|---|---|
| Category | Proteins |
| Description | CXCL10 Protein, Human, Recombinant (His) is expressed in E. coli expression system. The predicted molecular weight is 12.6 kDa and the accession number is P02778. |
| Tag | N-6xHis |
| Purity | 98.00% |
| Protein Sequence | VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP |
| UniProt ID | P02778 |
| MW | 12.6 kDa as predicted |
| Application notes | A hardcopy of COA with reconstitution instructions is sent along with the products. Please refer to it for detailed information. |
| Expression System | E. coli |
| Biological Origin | Human |
| Expression Region | 22-98 aa |
| Storage | -20°C |
| Note | For research use only |
CXCL9 Protein, Human, Recombinant (His) [orb1961238]
98.00%
16-18 KDa (reducing condition)
500 μg, 1 mg, 50 μg, 10 μgCXCL10 Protein, Human, Recombinant (hFc & His) [orb1962202]
98.00%
35 KDa (reducing condition)
1 mg, 500 μg, 10 μg, 50 μgHuman IP 10 (His) Protein [orb426656]
Greater than 95.0% as determined by(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
Escherichia Coli
5 μg, 25 μg, 1 mgRecombinant human CXCL10 Protein,N-MBP & C-His (HEK293) [orb2328450]
> 85% as determined by SDS-PAGE
20 μg, 50 μg, 100 μg
